IHome Zenergy Dream Mini IZBT7 Bruksanvisning
Läs nedan 📖 manual på svenska för IHome Zenergy Dream Mini IZBT7 (1 sidor) i kategorin Radio. Denna guide var användbar för 3 personer och betygsatt med 4.5 stjärnor i genomsnitt av 2 användare
Sida 1/1
DREAM MINI
Model: iZBT7
Bedside Sleep Therapy Machine
QUESTIONS? visit www.ihome.com
TOP P ANEL
FEATURES & FUNCTIONS
BACK PANEL
Plu g the included AC adapter in to the DC jack and connect the
plu g to a working outlet not controlled by a light switch.
RESET
RESET
TEST
TEST
FEATURES & FUNCTIONS
CLOCK DISPLAY
FAL L
ASLEEP
STAY
ASLEEP
BLU ETOOTH
SOU ND
THERAP Y
LIGHT
THERAP Y
ALARM 1
ALARM 2
PM INDICATOR
DST
SWITCH BATTERY
DOOR
BOTTOM PANEL
Backup Battery:
Th e built-in backu p ba ttery will maintain time an d alarm
settings in the event of a temporary power ou ta ge. To replace,
unscrew th e door on the bottom of th e unit and install a new
CR2450 battery into the compartment.
DST Switch:
Th e clock will au tomatically adjust during Dayligh t Saving
Time (DST) in March and November. To adjust man ually, slide
the DST Switch to +1 to add an hour or -1 to su btract an hour.
iHome
iZBT7
2s
CONNECTING TO BLUETOOTH
SETTING THE TIME
1. Press and hold the Time Set Butt on until the display flashes.
2. Press the + - or buttons to adjust the clock to the current time. (Hold for rapid
adjustment). Make sure you set the correct AM/PM time. The PM indicator will appear on
the t op left corner of the display. (There is no AM indicator.)
3. To toggle the clock display between 12 and 24 hour time, press Alarm 1 or Alarm 2
( or ) while the display is flashing.
4. Press and release the to confirm the time. The year will flash on the Time Set Button
display. Press the + or - buttons to adjust the year.
5. Press and release the Time Set Button to confirm the year. The date/month will flash
on the display. Press the + or buttons to adjust the date/month.-
6. Press and release the to confirm all settings.Time Set Button
SETTING ALARMS
ZENERGY BUTTON
Use the Zenergy Button to activate a calming sound and light therapy experience. You can also
customize your own sound and light therapy preferences by using our Fall Asleep and Stay Asleep
options to enable a relaxing sequence to gently help you fall asleep and gently transition to sound
masking mode for the remainder of the night, blocking out loud noises and helping you achieve your
deepest sleep.
Once you have confirmed your custom sleep settings for , press the Fall Asleep or Stay Alseep
Zenergy Button to activate one or both personalized sleep therapy programs. Press and hold the
Zenergy Button at any time to preview current settings.
FALL ASLEEP (LED WILL GLOW WHEN ACTIVATED)
The Fall Aslee p Butto n lets you choose f rom a selection of light and sound therapy opti ons
designed to trigg er your brain’s abi lity to relax and f all asleep quickly.
1. Press and hold the . Press the Fall Asleep But ton Sound The rapy Butto n to select a sound,
or p ress the Bluetooth bu tton to f all asleep to audi o from your Bluetooth device (your devi ce
mus t be connected to the i ZBT7). Then adjust the volu me using or .
2. Press again to confirm sound and volume settings. N ow press the Light Therapy B utton
t o cycle through light modes, and adjust the b rightness using the + - or buttons.
3. Press again to confirm light and b rightness setti ngs. Now choose a time duration
(10, 15, 30, 60, 90, or 120 minutes) using the + - or buttons. Press again to c onfirm all setting s.
4. Press the to activate your custom Fall Asleep settings. Zenergy Butto n
STAY ASLEEP (LED WILL GLOW WHEN ACTIVATED)
The St ay Aslee p B utt on lets you further personalize your own sleep therapy experience with
a gentle transiti on to sound and light op tions after the Fall Asl eep timer expires. The Stay Asleep
program will play for the remainder of the night to help you stay asleep.
1. P ress and hold the Stay Asleep But ton. P ress the So und Therapy Butto n to cycle through
sounds, then adjust the volume u sing or .
2. Press again to confirm sound and volume settings. N ow press the Light Therapy B utton
to cycle throu gh lig ht modes, and adj ust the brig htness using the + - or buttons.
3. Press again to confirm all settings.
4. Press the Zenergy Button to activate your custom Stay Asleep settings. The Stay Asleep function
will b e disabled once your alarm is activated. To manually disable, press the Stay Asleep button.
The corresp onding LED will shut o. © 2019 SDI Technologies, Inc. All rights reserved.
Questions? Visit ww w.ihome.com
WARRANTY
For product support information and warranty please visit: www.ihome.com/support
Sound Therapy uses specially recorded and engineered sounds to allow your mind to calm and prepare
for sleep. Press the Sound Therapy Button to access a variety of soothing sounds. Continue to press to
cycle to each mode:
#IWKFGFDTGCVJKPIOGFKVCVKQPVQUQQVJGDQF[CPFOKPFUGGPGZVRCIGHQTFGVCKNU
#DTGCVJKPIOGFKVCVKQPUQWPFGHHGEVHQTHQEWUCPFTGNCZCVKQPUGGPGZVRCIGHQTFGVCKNU
#VQPCNOGNQF[KPHTGSWGPEKGUVJCVOKOKEVJG&GNVCDTCKPYCXGUQHCOKPFKPOGFKVCVKQPQTJGCNKPI
UNGGR
#VQPCNOGNQF[KPHTGSWGPEKGUVJCVOKOKEVJG6JGVCDTCKPYCXGUQHCOKPFFTGCOKPIKP4'/UNGGR
9JKVGPQKUGCPF&GNVCVQPGOGNQFKGUNC[GTGFVQIGVJGTJGNRVQSWKGVCPQKU[GPXKTQPOGPVCPFCP
QXGTCEVKXGOKPF
#RGCEGHWNVQPCNOGNQF[FGUKIPGFVQSWKGVVJGOKPF
5RTKPIVKOGYQQFNCPFUQWPFU
9CXGUETCUJKPIQPCDGCEJ
(NQYKPIPCVWTCNTKXGTCHVGTCUVQTO
5WDVNGVJWPFGTCPFUVTQPITCKPHCNN
1WVFQQTYKPFEJKOGUCPFUQQVJKPIDTGG\G
$TQYPPQKUGKUCNQYVQPGFTGRGCVKPIHTGSWGPE[NKMGCHCPYJKEJJGNRUVQPGICVGFKUVTCEVKPI
GPXKTQPOGPVCNPQKUGU
#PCWVJGPVKECNN[TGEQTFGFECTTKFGKPVGTKQTVQPGICVGFKUVTCEVKPIGPXKTQPOGPVCNPQKUGU
2KPMPQKUGKUCOGFKWOVQPGFTGRGCVKPIHTGSWGPE[NKMGCUQQVJKPIYCVGTHCNNYJKEJJGNRUVQ
PGICVGFKUVTCEVKPIGPXKTQPOGPVCNPQKUGU
6JGUVCPFCTFYJKVGPQKUGTGRGCVKPIHTGSWGPE[NKMGTCFKQUVCVKEYJKEJJGNRUVQCEVKXGN[
PGICVGFKUVTCEVKPIGPXKTQPOGPVCNPQKUGU
/KOKEUVJGTJ[VJOQHCJGCTVDGCVVQRTQOQVGUVGCF[DTGCVJKPIRCVVGTPU
4-7-8:
Breath:
Zen:
Dream:
Peace:
Trance:
Nature:
Ocean:
River:
Storm:
Chimes:
Air:
Drive:
Focus:
Quie t:
Heart:
SOUND THERAPY
This unit has du al alarms that can be set for dierent times and dierent wake-to sources. Each is set
in the same way. Instructions are gi ven as ‘Alarm Button’ - use Alarm 1 or Alarm 2 B utto ns to set
respective alarms.
1. Press and hold the Alarm Button until the display flashes.
2. Press the buttons to adjust the alarm time. Make sure you set the correct AM/PM time. The PM + or -
indicator will appear on the top left corner of the display. (There is no AM indicator.)
3. Press the Alarm Butt on to confirm the alarm time. Next, set your alarm light therapy preference
by pressing the buttons. (If you choose Dawn or Sunrise, the pre-alarm will activate a light mode + or -
before your alarm sounds that will gradually increase in brightness for a duration of 10 minutes.)
4. Press the Alarm Button to confirm the alarm light mode. Next, press the + or - buttons to cycle
thr ough wake-to sources for your alarm: Bluetooth, buzzer, none or sound therapy modes.
Note: Sound therapy will not activate when an alarm is set to Bluetooth or buzzer modes.
5. Press the Alarm Button to confirm the wake-to source. If you chose to wake-to sound therapy, press
the + or - buttons to cycle through sound modes.
6. Press the Alarm Butto n to confirm wake-to volume. Press the + or - buttons to adjust wake-to sound
volume level.
7. Now press the to set the alarm schedule. Press the Alarm Butt on + or - buttons to cycle through
alarm schedules: 7 ( every day), 5 (weekdays only), or 2 (weekends only).
8. Press the Alarm Button to confirm all alarm settings. The alarm icon will appear on the display, and the
c orresponding alarm LED will glow on the top of the unit.
SNOOZING/STOPPING ALARMS
sTo sno oze a so unding alarm: P ress the Snooze/Dimmer Button to snooze for 9 minutes.
sTo st op a sounding alarm: Alarm B uttonPress the c orrespond ing (Alarm 1 or Alarm 2) or the
Power/Alarm Reset B utt on to d isable the alarm and reset it for the next day.
Press the Snooze/Dimmer button to adjust the brightness of the clock
di splay. Cycle through settings: Max, Mi d, Low, Min, Button (display
o/b uttons backlit), and Auto (display/buttons backli t for 15 second s).
LIGHT THERAPY
Press the Light Therapy Button repeatedly to cycle through light modes:
s
s$TGCVJ
s%CNO
s#WTQTC
s)NQY
2TGUUVJG CPF DWVVQPUVQCFLWUVVJGDTKIJVPGUU+ -
MEDITATION & BREATHING
Research has shown that active br eathing can calm the nervous syste m thereby reducing your heart rate
and activating the parasympathic (calming) ner vous system to im prove m em ory, positively impact
em otional behavior s to help cope with stress, anxie ty and make it easier to fall asleep.
Select the Sound and Light Therapy options to experience a soothing voice d 4-7-8 Breathing Meditation
guide that fades and synchronizes with pulsing lighting eects to control your breat h, lower your heart
rate and soothe the body and m ind.
4 sec Breathe in through your nose, filling the be lly.
7 sec Hold b reath.
8 sec Slowly exhale through your m outh.
Repeat.
Select the Breath Sound and Light Therapy options to experience a calm ing breathing sound eect that
can help coax your mind into a deep meditative state. This is a great alt ernative and easie r excercise than
the 4-7-8 m ethod.
5 sec Breathe in slowly through your nose .
5 sec Exhale slowly through your mouth.
Repeat.
SUNRISE WAKE UP
Circadian rhythm s, our int ernal clocks, are linke d to changing wavelengths of light throughout the day.
Light Therapy simulates these wavelengths, triggering subtle biological responses that can im prove your
slee p exper ience , energy and m ood.
Select the or Sun Dawn Wake to Light Therapy options to w ake up naturally with a sim ulated sunrise or
early dawn light experience that gradually increases to a bright glow 10 minute s be fore your alarm is set .
You can also customize alar ms that exclusively Wake t o Light to alert your toddler when it is ok to get out
of bed in the morning.
2TGU UVJG$NWGVQQVJD WVVQPVQUYKVEJHTQO5QWPF
6JGTCR[/QFGVQ$NWGVQQVJ/QFG
9JGPRNC[KPICWFKQRTGUUCPFJQNFVJG+C PF-
DWVVQPUQPVJGK<$6VQPCXKICVGVTCEMU
s1PG%QNQT
s2WNUG
s'PGTI[
s.COR
s1((
-1 + 1 auto
DST
start/preview
ala rm reset li ght ther apy sound the rapy
fal l aslee p stay aslee p wake up 1 wak e up 2
tim e set
set / light volu me
play/pauseblue tooth
(#..
#5.''2
.'&
56#;#5.''2
.'& #.#4/.'&
#.#4/
.'&
iZBT7-111319-C Printed in China
•
Do not use this apparatus nea r water
•
Clean only with dry cloth
•
Do not block any ventilation opening
•
Unplug this appa ratus during lightning storm or when unused for long periods of time
Warning: To reduce the risk of fire or electric shock, do not expose this appliance to rain or moisture
Damage Requiring Service - This product should be serviced by qualified service personnel when:
- Plug has been damaged.
- objects have fallen into or liquid has been spilled into the enc losure.
- the unit has been exposed to rain.
- the unit has been dropped or the enc losure da maged.
- the unit exhibits a marked change in performance or does not operate normally
CAUTION – Danger of explosion if battery is incorrectly replaced. Replace only with the same or equivalent type
The mains plug of power adaptor is used as the disconnect device, it shall remain readily operable.
IMPORTANT SAFETY INSTRUCTIONS
Please heed all warnings, read and follow all instruc tions and keep these instructions handy fo r future refere nce.
Heat – The unit should be situated away from heat sources suc h as radiators, heat registers, stoves or other appliance s
(including amplifiers) that pro duce heat.
Only use attac hments/access ories spec ified by the manufacturer. This pro duct is suitable for use in tropica l and/or moderate
climates. The unit should be serviced by qualified service personnel when the enclosure damaged or doe s not ope rate normally. No
naked flame source s, such as lighted candles, should be placed on the apparatus.
WARNING
Do not ingest the battery, Chemical Burn Hazard. This product contains a coin/button cell battery. If the coin/button cell battery
is swallowed, it can cause severe internal burns in just 2 hours and can lead to death. Keep new and used batteries away from
children. If the battery compartment does not close securely, stop using the product and keep it away from childre n. If you think
batteries might have been swallowed or placed inside any part of the body, seek immediate medical attention.
iZBT7
FCC ID: EMOIZBT7
IC: 986B-IZBT7
This devic e complies with Part 15 of the FCC Rules, operation is subject to the following two
conditio ns: (1) This device may not c ause harmful interference, and (2) this device must accept any
interference received, including interference that may cause undesired operation.
FCC INFORMATION
FCC Radiation Exposure Statement
This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment.
• Warning : Changes or modifications to this unit not express ly approved by the party resp onsible for compliance could void the
user’s authority to operate the equipment.
• NOTE: This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of the
FCC Rules.
These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment
generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the ins tructions , may
cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular
installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning
the equipment o and on, the user is encouraged to try to correct the interference by one or more of the following measures:
• Reorient or relocate the receiving antenna.
• Increase the separation between the equipment and receiver.
• Connect the equipment into an outlet on a circuit dierent from that to which the receiver is connected.
• Consult the dealer or an experienced radio/TV technician for help. CAN ICES-3 (B)/NMB-3(B)
Canada IC statement
This device contains licence-exempt transmitter(s)/receiver(s) that comply with Innovation, Science and Economic Development
Canada’s licence-exempt RSS(s). Operation is subject to the following two conditions:
1. This device may not cause interference.
2. This device must accept any interference, including interference that may cause undesired operation of the device.
L’émetteur/récepteur exempt de licence contenu dans le présent appareil est conforme aux CNR d’Innovation, Sciences et
Développement économique Canada applicables aux appareils radio exempts de licence. L’exploitation est autorisée aux deux
conditions s uivantes :
(1) L’appareil ne doit pas produire de brouillage;
(2) L’appareil doit accepter tout brouillage radioélectrique subi, même si le brouillage est sus ceptible d’en compromettre le
fonctionnement.
Produktspecifikationer
| Varumärke: | IHome |
| Kategori: | Radio |
| Modell: | Zenergy Dream Mini IZBT7 |
Behöver du hjälp?
Om du behöver hjälp med IHome Zenergy Dream Mini IZBT7 ställ en fråga nedan och andra användare kommer att svara dig
Radio IHome Manualer
18 September 2024
18 September 2024
18 September 2024
18 September 2024
18 September 2024
18 September 2024
18 September 2024
18 September 2024
18 September 2024
18 September 2024
Radio Manualer
- Radio Sony
- Radio Xiaomi
- Radio Bosch
- Radio AEG
- Radio Philips
- Radio Panasonic
- Radio Daewoo
- Radio DeWalt
- Radio Garmin
- Radio Grundig
- Radio JVC
- Radio JBL
- Radio Kenwood
- Radio Karcher
- Radio Motorola
- Radio Medion
- Radio Quigg
- Radio Topcom
- Radio Yamaha
- Radio Adler
- Radio Aiwa
- Radio Albrecht
- Radio Akai
- Radio Acoustic Energy
- Radio Argon
- Radio OneConcept
- Radio Lexibook
- Radio Sharp
- Radio Telefunken
- Radio Silvercrest
- Radio Makita
- Radio Hitachi
- Radio Nedis
- Radio Thomson
- Radio Tristar
- Radio Lenco
- Radio Pyle
- Radio Vonroc
- Radio Audizio
- Radio Stanley
- Radio Manta
- Radio GPO
- Radio Caliber
- Radio Timex
- Radio OK
- Radio Hyundai
- Radio Sonoro
- Radio Renkforce
- Radio ECG
- Radio Moulinex
- Radio Ryobi
- Radio Bush
- Radio Clatronic
- Radio Lowrance
- Radio Sencor
- Radio GPX
- Radio Festool
- Radio Blaupunkt
- Radio Metabo
- Radio Logik
- Radio Milwaukee
- Radio Telestar
- Radio Salora
- Radio Denver
- Radio Imperial
- Radio Schneider
- Radio Sanyo
- Radio Vitek
- Radio Einhell
- Radio Hama
- Radio Soundmaster
- Radio Brigmton
- Radio Denon
- Radio Sunstech
- Radio Sennheiser
- Radio Maginon
- Radio Midland
- Radio GlobalTronics
- Radio Technisat
- Radio GoGEN
- Radio Rockford Fosgate
- Radio Marquant
- Radio Nordmende
- Radio AudioAffairs
- Radio Krüger And Matz
- Radio Binatone
- Radio Steren
- Radio Kicker
- Radio Bose
- Radio Audiosonic
- Radio Clarion
- Radio Proline
- Radio Coby
- Radio Crosley
- Radio Envivo
- Radio Muse
- Radio Teufel
- Radio Bigben Interactive
- Radio Kathrein
- Radio Olympia
- Radio Pure
- Radio Powerplus
- Radio Porter-Cable
- Radio Uniden
- Radio Audiovox
- Radio Ion
- Radio Roberts
- Radio Yaesu
- Radio Tesco
- Radio Artsound
- Radio Dual
- Radio Boss
- Radio Terris
- Radio Oricom
- Radio Camry
- Radio Cobra
- Radio MB Quart
- Radio Switel
- Radio Bigben
- Radio Auna
- Radio Alba
- Radio Clas Ohlson
- Radio Naxa
- Radio Lexon
- Radio Sven
- Radio Ricatech
- Radio Konig
- Radio Boston Acoustics
- Radio Icom
- Radio Mpman
- Radio Trevi
- Radio Sogo
- Radio JL Audio
- Radio Zebra
- Radio Technaxx
- Radio Nikkei
- Radio PerfectPro
- Radio Peaq
- Radio Freecom
- Radio Jensen
- Radio Roadstar
- Radio Gira
- Radio Scott
- Radio Jung
- Radio Sangean
- Radio Basetech
- Radio Dnt
- Radio Balance
- Radio Audio Pro
- Radio HQ
- Radio Be Cool
- Radio Noveen
- Radio Karcher Audio
- Radio CRUX
- Radio Fusion
- Radio August
- Radio Infinity
- Radio AIC
- Radio Ruarkaudio
- Radio Tivoli Audio
- Radio Go Green
- Radio Victrola
- Radio Linn
- Radio Numan
- Radio Elta
- Radio Iluv
- Radio Monitor Audio
- Radio TELEX
- Radio Multiplex
- Radio Tangent
- Radio SPC
- Radio Stabo
- Radio Clint
- Radio Soundstream
- Radio Xoro
- Radio Sagemcom
- Radio Woxter
- Radio Xhdata
- Radio Monacor
- Radio Noxon
- Radio Orava
- Radio Geneva
- Radio Ferguson
- Radio Wet Sounds
- Radio DAP Audio
- Radio Reflexion
- Radio Duronic
- Radio Scansonic
- Radio TFA Dostmann
- Radio Audisse
- Radio ETON
- Radio Lenoxx
- Radio H-Tronic
- Radio Equity
- Radio Intertechno
- Radio Schwaiger
- Radio EKO
- Radio Pinell
- Radio Aquatic AV
- Radio Digitalbox
- Radio Ruark Audio
- Radio NUVO
- Radio Narex
- Radio Tiny Audio
- Radio Klein Tools
- Radio E-bench
- Radio Peha
- Radio Sanwa
- Radio Sailor
- Radio SSV Works
- Radio Microlab
- Radio QFX
- Radio Voxx
- Radio SACK It
- Radio BasicXL
- Radio Roth
- Radio Majestic
- Radio Ices Electronics
- Radio AmpliVox
- Radio Memphis Audio
- Radio AMX
- Radio Elbe
- Radio GBS Elettronica
- Radio Sang
- Radio Gewiss
- Radio Lutron
- Radio Axxess
- Radio Majority
- Radio Retekess
- Radio Wintal
- Radio Acoustic Solutions
- Radio Atlantis Land
- Radio Ranger
- Radio BLUEPALM
- Radio Weather X
- Radio Data-Tronix
- Radio Aconatic
- Radio Mebby
- Radio Yamazen
Nyaste Radio Manualer
27 Oktober 2024
26 Oktober 2024
24 Oktober 2024
24 Oktober 2024
24 Oktober 2024
23 Oktober 2024
22 Oktober 2024
20 Oktober 2024
19 Oktober 2024
18 Oktober 2024